Amyloid β Peptide (40-1), Human
$135.00
Sequence: VVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD
Purity: >99% Counterion: Ammonium bicarbonate
Description
A reversed, inactive sequence of the Amyloid β peptide (1-40) commonly used as a control peptide. Aß (1-40) together with Aß (1-42) are two major C-terminal variants of the Aß protein constituting the majority of Aßs. These undergo post-secretory aggregation and deposition in the Alzheimer’s disease brain.
Related products
-
Amyloid β Peptide (42-1), Human
$135.00 – $480.00 Select options This product has multiple variants. The options may be chosen on the product page -
Amyloid β Peptide (1-40), Human
$85.00 – $345.00 Select options This product has multiple variants. The options may be chosen on the product page -
Amyloid β Peptide (1-42), Human
$135.00 – $310.00 Select options This product has multiple variants. The options may be chosen on the product page -
Amyloid β Peptide (1-42) Scrambled, Human
$135.00 – $480.00 Select options This product has multiple variants. The options may be chosen on the product page