Amyloid β Peptide (1-42) Scrambled, Human
$135.00 – $480.00
Sequence: KVKGLIDGDHIGDLVYEFMDSNSAIFREGVGAGHVHVAQVEF
Purity: >99% Counterion: Ammonium bicarbonate
Description
Scrambled amyloid β peptide (1-42) is amyloid β (1-42) with scrambled sequence. It therefore has the same amino acid composition but different sequence and is often used as a control peptide. Beta amyloid (1-42) is a member of beta amyloid-peptides, which are involved in the amyloid beta-peptide (A beta)-associated free radical oxidative stress model for neuronal death in Alzheimer’s disease (AD) brain.
Related products
-
Amyloid β Peptide (1-40), Human
$85.00 – $345.00 Select options This product has multiple variants. The options may be chosen on the product page -
Amyloid β Peptide (40-1), Human
$135.00 Select options This product has multiple variants. The options may be chosen on the product page -
Amyloid β Peptide (42-1), Human
$135.00 – $480.00 Select options This product has multiple variants. The options may be chosen on the product page -
Amyloid β Peptide (1-42), Human
$135.00 – $310.00 Select options This product has multiple variants. The options may be chosen on the product page